Lineage for d2glsb1 (2gls B:1-100)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30769Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 30770Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 30771Protein Glutamine synthetase, N-terminal domain [54370] (1 species)
  7. 30772Species Salmonella typhimurium [TaxId:90371] [54371] (4 PDB entries)
  8. 30788Domain d2glsb1: 2gls B:1-100 [37852]
    Other proteins in same PDB: d2glsa2, d2glsb2, d2glsc2, d2glsd2, d2glse2, d2glsf2, d2glsg2, d2glsh2, d2glsi2, d2glsj2, d2glsk2, d2glsl2

Details for d2glsb1

PDB Entry: 2gls (more details), 3.5 Å

PDB Description: refined atomic model of glutamine synthetase at 3.5 angstroms resolution

SCOP Domain Sequences for d2glsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2glsb1 d.15.9.1 (B:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d2glsb1:

Click to download the PDB-style file with coordinates for d2glsb1.
(The format of our PDB-style files is described here.)

Timeline for d2glsb1: