Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6u3ma2: 6u3m A:82-181 [378513] Other proteins in same PDB: d6u3ma1, d6u3mb1, d6u3mb2, d6u3mc1, d6u3md1, d6u3md2 automated match to d5ujta2 complexed with gol, nag, po4 |
PDB Entry: 6u3m (more details), 1.9 Å
SCOPe Domain Sequences for d6u3ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u3ma2 b.1.1.2 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]} atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks dhsffkisyltllpsaeesydckvehwgldkpllkhwepe
Timeline for d6u3ma2: