SCOPe 2.08: Domain d6u3ma1: 6u3m A:1-81

Lineage for d6u3ma1 (6u3m A:1-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d6u3ma1: 6u3m A:1-81 [378512]
   Other proteins in same PDB: d6u3ma2, d6u3mb2, d6u3mc2, d6u3md2
   automated match to d5ujta1
   complexed with gol, nag, po4

Details for d6u3ma1

PDB Entry: 6u3m, 1.9 Å

PDB Description: dq2-p.fluor-alpha1a

PDB Compounds: (A:) HLA class II histocompatibility antigen, DQ alpha 1 chain

SCOPe Domain Sequences for d6u3ma1:

Sequence; same for both SEQRES and ATOM records:

>d6u3ma1 d.19.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfal
tniavlkhnlnslikrsnsta

Timeline for d6u3ma1:

• d6u3ma1 first appeared in SCOPe 2.07