Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) |
Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
Protein Glutamine synthetase, N-terminal domain [54370] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries) |
Domain d1f52i1: 1f52 I:1-100 [37847] Other proteins in same PDB: d1f52a2, d1f52b2, d1f52c2, d1f52d2, d1f52e2, d1f52f2, d1f52g2, d1f52h2, d1f52i2, d1f52j2, d1f52k2, d1f52l2 |
PDB Entry: 1f52 (more details), 2.49 Å
SCOP Domain Sequences for d1f52i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f52i1 d.15.9.1 (I:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
Timeline for d1f52i1: