SCOPe 2.08: Domain d6u3oh2: 6u3o H:130-256

Lineage for d6u3oh2 (6u3o H:130-256)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d6u3oh2: 6u3o H:130-256 [378450]
Other proteins in same PDB: d6u3oa1, d6u3ob1, d6u3oc1, d6u3od1, d6u3od2, d6u3oe1, d6u3of1, d6u3of2, d6u3og1, d6u3oh1
automated match to d3of6b2

Details for d6u3oh2

PDB Entry: 6u3o (more details), 2.74 Å

PDB Description: jr51 dq2-p.aeru-alpha2a complex

PDB Compounds: (H:) T-CELL RECEPTOR, JR5.1 beta

SCOPe Domain Sequences for d6u3oh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u3oh2 b.1.1.2 (H:130-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

SCOPe Domain Coordinates for d6u3oh2:

Click to download the PDB-style file with coordinates for d6u3oh2.
(The format of our PDB-style files is described here.)

Timeline for d6u3oh2: