Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species [kitasatospora] papulosa [TaxId:1464011] [378268] (1 PDB entry) |
Domain d6ndqa1: 6ndq A:1-186 [378369] Other proteins in same PDB: d6ndqa2, d6ndqb2 automated match to d4gboa_ |
PDB Entry: 6ndq (more details), 1.6 Å
SCOPe Domain Sequences for d6ndqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ndqa1 b.1.18.0 (A:1-186) automated matches {[kitasatospora] papulosa [TaxId: 1464011]} hgsvvdpasrnygcwlrwgddfqnpameqedpmcwqawqadpnamwnwnglyrngsggdf paavpdgqlcsggrtesgrydsldsvgawkttditddftvklydqashgadyfqvyvtrq gfdpaaealtwsdlqlvaetgryapsqnyeipvttsglsgrhvvytiwqashmdqtyflc sdvnft
Timeline for d6ndqa1: