Lineage for d6ndqa1 (6ndq A:1-186)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766623Species [kitasatospora] papulosa [TaxId:1464011] [378268] (1 PDB entry)
  8. 2766624Domain d6ndqa1: 6ndq A:1-186 [378369]
    Other proteins in same PDB: d6ndqa2, d6ndqb2
    automated match to d4gboa_

Details for d6ndqa1

PDB Entry: 6ndq (more details), 1.6 Å

PDB Description: crystal structure of a lpmo from kitasatospora papulosa
PDB Compounds: (A:) Lytic polysaccharide monooxygenase

SCOPe Domain Sequences for d6ndqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ndqa1 b.1.18.0 (A:1-186) automated matches {[kitasatospora] papulosa [TaxId: 1464011]}
hgsvvdpasrnygcwlrwgddfqnpameqedpmcwqawqadpnamwnwnglyrngsggdf
paavpdgqlcsggrtesgrydsldsvgawkttditddftvklydqashgadyfqvyvtrq
gfdpaaealtwsdlqlvaetgryapsqnyeipvttsglsgrhvvytiwqashmdqtyflc
sdvnft

SCOPe Domain Coordinates for d6ndqa1:

Click to download the PDB-style file with coordinates for d6ndqa1.
(The format of our PDB-style files is described here.)

Timeline for d6ndqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ndqa2