SCOPe 2.08: Domain d2ptla_: 2ptl A:

Lineage for d2ptla_ (2ptl A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)

8. Domain d2ptla_: 2ptl A: [37835]
   b1 domain

Details for d2ptla_

PDB Entry: 2ptl

PDB Description: three-dimensional solution structure of an immunoglobulin light chain- binding domain of protein l. comparison with the igg-binding domains of protein g

PDB Compounds: (A:) protein l

SCOPe Domain Sequences for d2ptla_:

Sequence; same for both SEQRES and ATOM records:

>d2ptla_ d.15.7.1 (A:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
enkeetpetpetdseeevtikanlifangstqtaefkgtfekatseayayadtlkkdnge
ytvdvadkgytlnikfag

Timeline for d2ptla_:

• d2ptla_ first appeared (with stable ids) in SCOP 1.55, called d2ptl__
  
• d2ptla_ appears in SCOPe 2.07