Lineage for d2igh__ (2igh -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30743Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 30744Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 30748Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 30749Species Streptococcus sp., group G [TaxId:1306] [54361] (14 PDB entries)
  8. 30762Domain d2igh__: 2igh - [37832]

Details for d2igh__

PDB Entry: 2igh (more details)

PDB Description: determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr
PDB Compounds: ( :)

SCOP Domain Sequences for d2igh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igh__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
ltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
e

SCOP Domain Coordinates for d2igh__:

Click to download the PDB-style file with coordinates for d2igh__.
(The format of our PDB-style files is described here.)

Timeline for d2igh__: