SCOP 1.73: Domain d2igga_: 2igg A:

Lineage for d2igga_ (2igg A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries)

8. Domain d2igga_: 2igg A: [37831]

Details for d2igga_

PDB Entry: 2igg

PDB Description: determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr

PDB Compounds: (A:) protein g

SCOP Domain Sequences for d2igga_:

Sequence; same for both SEQRES and ATOM records:

>d2igga_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
ltpavttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt
ekpe

Timeline for d2igga_:

• d2igga_ first appeared (with stable ids) in SCOP 1.55, called d2igg__
  
• d2igga_ was called d2igg__ in SCOP 1.71
  
• d2igga_ appears in SCOP 1.75
  
• d2igga_ appears in the current release, SCOPe 2.08