Lineage for d2igg__ (2igg -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325904Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 325905Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 325929Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 325930Species Streptococcus sp., group G [TaxId:1306] [54361] (21 PDB entries)
  8. 325964Domain d2igg__: 2igg - [37831]

Details for d2igg__

PDB Entry: 2igg (more details)

PDB Description: determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr

SCOP Domain Sequences for d2igg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igg__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
ltpavttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt
ekpe

SCOP Domain Coordinates for d2igg__:

Click to download the PDB-style file with coordinates for d2igg__.
(The format of our PDB-style files is described here.)

Timeline for d2igg__: