Lineage for d6neia1 (6nei A:1-103)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2695147Species Thalictrum flavum [TaxId:150095] [318179] (8 PDB entries)
  8. 2695154Domain d6neia1: 6nei A:1-103 [378306]
    Other proteins in same PDB: d6neia2, d6neia3, d6neib2
    automated match to d1kyze1
    complexed with so4

Details for d6neia1

PDB Entry: 6nei (more details), 1.85 Å

PDB Description: scoulerine 9-o-methyltransferase from thalictrum flavum
PDB Compounds: (A:) (S)-scoulerine 9-O-methyltransferase

SCOPe Domain Sequences for d6neia1:

Sequence, based on SEQRES records: (download)

>d6neia1 a.4.5.0 (A:1-103) automated matches {Thalictrum flavum [TaxId: 150095]}
malqegvnylsglglsrliclpmalraaielnvfeiifqagpeaqlspaeivakiptknp
naaialdrilrmlgassilsvttmkdgrvyglteesrclvadk

Sequence, based on observed residues (ATOM records): (download)

>d6neia1 a.4.5.0 (A:1-103) automated matches {Thalictrum flavum [TaxId: 150095]}
malqegvnylsglglsrliclpmalraaielnvfeiifqageaqlspaeivakiptknpn
aaialdrilrmlgassilsvttmgrvyglteesrclvadk

SCOPe Domain Coordinates for d6neia1:

Click to download the PDB-style file with coordinates for d6neia1.
(The format of our PDB-style files is described here.)

Timeline for d6neia1: