Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species) |
Species Streptococcus sp., group G [TaxId:1306] [54361] (35 PDB entries) |
Domain d1igca_: 1igc A: [37827] Other proteins in same PDB: d1igch1, d1igch2, d1igcl1, d1igcl2 |
PDB Entry: 1igc (more details), 2.6 Å
SCOPe Domain Sequences for d1igca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igca_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} avttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte
Timeline for d1igca_:
View in 3D Domains from other chains: (mouse over for more information) d1igch1, d1igch2, d1igcl1, d1igcl2 |