SCOPe 2.05: Domain d1pgba_: 1pgb A:

Lineage for d1pgba_ (1pgb A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (33 PDB entries)

8. Domain d1pgba_: 1pgb A: [37824]

Details for d1pgba_

PDB Entry: 1pgb, 1.92 Å

PDB Description: two crystal structures of the b1 immunoglobulin-binding domain of streptoccocal protein g and comparison with nmr

PDB Compounds: (A:) protein g

SCOPe Domain Sequences for d1pgba_:

Sequence; same for both SEQRES and ATOM records:

>d1pgba_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

Timeline for d1pgba_:

• d1pgba_ first appeared (with stable ids) in SCOP 1.55, called d1pgb__
  
• d1pgba_ appears in SCOPe 2.04
  
• d1pgba_ appears in SCOPe 2.06
  
• d1pgba_ appears in the current release, SCOPe 2.08