SCOPe 2.08: Domain d6iy1e_: 6iy1 E:

Lineage for d6iy1e_ (6iy1 E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6iy1e_: 6iy1 E: [378235]
   Other proteins in same PDB: d6iy1f_
   automated match to d4lx0a_
   complexed with gdp

Details for d6iy1e_

PDB Entry: 6iy1, 2.11 Å

PDB Description: structure of human ras-related protein rab11

PDB Compounds: (E:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d6iy1e_:

Sequence, based on SEQRES records:

>d6iy1e_ c.37.1.8 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdta
gqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdl
rhlravptdearafaeknglsfietsaldstnveaafqtilteiy

Sequence, based on observed residues (ATOM records):

>d6iy1e_ c.37.1.8 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdta
gryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlrh
lravptdearafaeknglsfietsaldstnveaafqtilteiy

Timeline for d6iy1e_:

• d6iy1e_ first appeared in SCOPe 2.07