SCOP 1.55: Domain d1pgx__: 1pgx -

Lineage for d1pgx__ (1pgx -)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (14 PDB entries)

8. Domain d1pgx__: 1pgx - [37823]

Details for d1pgx__

PDB Entry: 1pgx, 1.66 Å

PDB Description: the 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain

SCOP Domain Sequences for d1pgx__:

Sequence; same for both SEQRES and ATOM records:

>d1pgx__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
eltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftv
temvtevpva

Timeline for d1pgx__:

• d1pgx__ appears in SCOP 1.57
  
• d1pgx__ appears in the current release, SCOPe 2.08, called d1pgxa_