Lineage for d1pgx__ (1pgx -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30743Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 30744Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 30748Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 30749Species Streptococcus sp., group G [TaxId:1306] [54361] (14 PDB entries)
  8. 30752Domain d1pgx__: 1pgx - [37823]

Details for d1pgx__

PDB Entry: 1pgx (more details), 1.66 Å

PDB Description: the 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain
PDB Compounds: ( :)

SCOP Domain Sequences for d1pgx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgx__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
eltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftv
temvtevpva

SCOP Domain Coordinates for d1pgx__:

Click to download the PDB-style file with coordinates for d1pgx__.
(The format of our PDB-style files is described here.)

Timeline for d1pgx__: