SCOPe 2.08: Domain d1pgxa_: 1pgx A:

Lineage for d1pgxa_ (1pgx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)

8. Domain d1pgxa_: 1pgx A: [37823]

Details for d1pgxa_

PDB Entry: 1pgx, 1.66 Å

PDB Description: the 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain

PDB Compounds: (A:) protein g

SCOPe Domain Sequences for d1pgxa_:

Sequence; same for both SEQRES and ATOM records:

>d1pgxa_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
eltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftv
temvtevpva

Timeline for d1pgxa_:

• d1pgxa_ first appeared (with stable ids) in SCOP 1.55, called d1pgx__
  
• d1pgxa_ appears in SCOPe 2.07