![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) |
![]() | Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species) |
![]() | Species Streptococcus sp., group G [TaxId:1306] [54361] (24 PDB entries) |
![]() | Domain d1igd__: 1igd - [37822] |
PDB Entry: 1igd (more details), 1.1 Å
SCOP Domain Sequences for d1igd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igd__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G} mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt e
Timeline for d1igd__: