Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) |
Domain d6ea4b2: 6ea4 B:272-546 [378189] Other proteins in same PDB: d6ea4a1, d6ea4a3, d6ea4a4, d6ea4a5, d6ea4b1, d6ea4b3, d6ea4b4, d6ea4b5 automated match to d3se6a2 complexed with j2g, lys, mes, nag, zn |
PDB Entry: 6ea4 (more details), 2.45 Å
SCOPe Domain Sequences for d6ea4b2:
Sequence, based on SEQRES records: (download)
>d6ea4b2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg gvchsdpkmtsnmlaflgenaevkemmttwtlqkg
>d6ea4b2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnvkemmttwtl qkg
Timeline for d6ea4b2: