Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d6ca9c1: 6ca9 C:1-106 [378177] Other proteins in same PDB: d6ca9a2, d6ca9c2 automated match to d1dn0a1 complexed with gol, peg |
PDB Entry: 6ca9 (more details), 2.7 Å
SCOPe Domain Sequences for d6ca9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ca9c1 b.1.1.1 (C:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip drfsgsgsgtdftltisrlepedfavyycqqsarsftfgpgtkvdi
Timeline for d6ca9c1:
View in 3D Domains from other chains: (mouse over for more information) d6ca9a1, d6ca9a2, d6ca9b_, d6ca9d_ |