SCOPe 2.08: Domain d6utnb1: 6utn B:1-148,B:313-330

Lineage for d6utnb1 (6utn B:1-148,B:313-330)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)

7. Species Escherichia coli [TaxId:562] [51802] (12 PDB entries)
   Uniprot P06977

8. Domain d6utnb1: 6utn B:1-148,B:313-330 [378171]
   Other proteins in same PDB: d6utna2, d6utnb2
   automated match to d1gado1
   complexed with act, g3p, mse, na, po4

Details for d6utnb1

PDB Entry: 6utn, 1.79 Å

PDB Description: native e. coli glyceraldehyde 3-phosphate dehydrogenase

PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d6utnb1:

Sequence; same for both SEQRES and ATOM records:

>d6utnb1 c.2.1.3 (B:1-148,B:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

Timeline for d6utnb1:

• d6utnb1 first appeared in SCOPe 2.07