Lineage for d1fnwe2 (1fnw E:1308-1421)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254362Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 254363Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 254415Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 254416Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries)
  8. 254441Domain d1fnwe2: 1fnw E:1308-1421 [37817]
    Other proteins in same PDB: d1fnwa1, d1fnwb1, d1fnwc1, d1fnwd1, d1fnwe1, d1fnwf1, d1fnwg1, d1fnwh1

Details for d1fnwe2

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnwe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwe2 d.15.6.1 (E:1308-1421) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOP Domain Coordinates for d1fnwe2:

Click to download the PDB-style file with coordinates for d1fnwe2.
(The format of our PDB-style files is described here.)

Timeline for d1fnwe2: