Lineage for d6utma1 (6utm A:1-148,A:313-330)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2428331Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2428572Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2428628Species Escherichia coli [TaxId:562] [51802] (12 PDB entries)
    Uniprot P06977
  8. 3078081Domain d6utma1: 6utm A:1-148,A:313-330 [378143]
    Other proteins in same PDB: d6utma2, d6utmb2
    automated match to d1gado1
    complexed with g3p, gol, na

Details for d6utma1

PDB Entry: 6utm (more details), 2.14 Å

PDB Description: native e. coli glyceraldehyde 3-phosphate dehydrogenase
PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d6utma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6utma1 c.2.1.3 (A:1-148,A:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOPe Domain Coordinates for d6utma1:

Click to download the PDB-style file with coordinates for d6utma1.
(The format of our PDB-style files is described here.)

Timeline for d6utma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6utma2