Lineage for d1fnwa2 (1fnw A:108-221)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541578Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 2541579Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 2541604Domain d1fnwa2: 1fnw A:108-221 [37813]
    Other proteins in same PDB: d1fnwa1, d1fnwb1, d1fnwc1, d1fnwd1, d1fnwe1, d1fnwf1, d1fnwg1, d1fnwh1
    complexed with cd

Details for d1fnwa2

PDB Entry: 1fnw (more details), 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a
PDB Compounds: (A:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnwa2 d.15.6.1 (A:108-221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOPe Domain Coordinates for d1fnwa2:

Click to download the PDB-style file with coordinates for d1fnwa2.
(The format of our PDB-style files is described here.)

Timeline for d1fnwa2: