SCOPe 2.07: Domain d6r2wt2: 6r2w T:107-210

Lineage for d6r2wt2 (6r2w T:107-210)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d6r2wt2: 6r2w T:107-210 [378121]
   Other proteins in same PDB: d6r2wh_, d6r2wl1, d6r2wl2, d6r2wl3
   automated match to d1j9ct2
   complexed with 0z7, bgc, ca, fuc, tma, xys

Details for d6r2wt2

PDB Entry: 6r2w, 1.25 Å

PDB Description: crystal structure of the super-active fviia variant vyt in complex with tissue factor

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d6r2wt2:

Sequence; same for both SEQRES and ATOM records:

>d6r2wt2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Timeline for d6r2wt2:

• d6r2wt2 is new in SCOPe 2.07-stable
  
• d6r2wt2 appears in the current release, SCOPe 2.08