SCOP 1.71: Domain d1b1zd2: 1b1z D:108-220

Lineage for d1b1zd2 (1b1z D:108-220)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)

8. Domain d1b1zd2: 1b1z D:108-220 [37808]
   Other proteins in same PDB: d1b1za1, d1b1zb1, d1b1zc1, d1b1zd1

Details for d1b1zd2

PDB Entry: 1b1z, 2.57 Å

PDB Description: streptococcal pyrogenic exotoxin a1

SCOP Domain Sequences for d1b1zd2:

Sequence; same for both SEQRES and ATOM records:

>d1b1zd2 d.15.6.1 (D:108-220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt

Timeline for d1b1zd2:

• d1b1zd2 first appeared (with stable ids) in SCOP 1.55
  
• d1b1zd2 appears in SCOP 1.69
  
• d1b1zd2 appears in SCOP 1.73
  
• d1b1zd2 appears in the current release, SCOPe 2.08