Lineage for d1b1zb2 (1b1z B:108-220)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325819Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 325820Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries)
  8. 325826Domain d1b1zb2: 1b1z B:108-220 [37806]
    Other proteins in same PDB: d1b1za1, d1b1zb1, d1b1zc1, d1b1zd1

Details for d1b1zb2

PDB Entry: 1b1z (more details), 2.57 Å

PDB Description: streptococcal pyrogenic exotoxin a1

SCOP Domain Sequences for d1b1zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1zb2 d.15.6.1 (B:108-220) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievyltt

SCOP Domain Coordinates for d1b1zb2:

Click to download the PDB-style file with coordinates for d1b1zb2.
(The format of our PDB-style files is described here.)

Timeline for d1b1zb2: