SCOP 1.71: Domain d1fnud2: 1fnu D:1008-1121

Lineage for d1fnud2 (1fnu D:1008-1121)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)

8. Domain d1fnud2: 1fnu D:1008-1121 [37804]
   Other proteins in same PDB: d1fnua1, d1fnub1, d1fnuc1, d1fnud1
   complexed with cd

Details for d1fnud2

PDB Entry: 1fnu, 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnud2:

Sequence; same for both SEQRES and ATOM records:

>d1fnud2 d.15.6.1 (D:1008-1121) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

Timeline for d1fnud2:

• d1fnud2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnud2 appears in SCOP 1.69
  
• d1fnud2 appears in SCOP 1.73
  
• d1fnud2 appears in the current release, SCOPe 2.08