Lineage for d1fnud2 (1fnu D:1008-1121)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 408294Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 408295Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 408352Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 408353Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries)
  8. 408357Domain d1fnud2: 1fnu D:1008-1121 [37804]
    Other proteins in same PDB: d1fnua1, d1fnub1, d1fnuc1, d1fnud1
    complexed with cd

Details for d1fnud2

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a

SCOP Domain Sequences for d1fnud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnud2 d.15.6.1 (D:1008-1121) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOP Domain Coordinates for d1fnud2:

Click to download the PDB-style file with coordinates for d1fnud2.
(The format of our PDB-style files is described here.)

Timeline for d1fnud2: