![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [54357] (7 PDB entries) |
![]() | Domain d1fnud2: 1fnu D:1008-1121 [37804] Other proteins in same PDB: d1fnua1, d1fnub1, d1fnuc1, d1fnud1 complexed with cd |
PDB Entry: 1fnu (more details), 1.94 Å
SCOP Domain Sequences for d1fnud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnud2 d.15.6.1 (D:1008-1121) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes} gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk
Timeline for d1fnud2: