Lineage for d1fnuc2 (1fnu C:708-821)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639209Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1639210Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1639309Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 1639310Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 1639313Domain d1fnuc2: 1fnu C:708-821 [37803]
    Other proteins in same PDB: d1fnua1, d1fnub1, d1fnuc1, d1fnud1
    complexed with cd

Details for d1fnuc2

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a
PDB Compounds: (C:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnuc2 d.15.6.1 (C:708-821) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

SCOPe Domain Coordinates for d1fnuc2:

Click to download the PDB-style file with coordinates for d1fnuc2.
(The format of our PDB-style files is described here.)

Timeline for d1fnuc2: