| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
| Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries) Uniprot P08095 |
| Domain d1fnub2: 1fnu B:408-521 [37802] Other proteins in same PDB: d1fnua1, d1fnub1, d1fnuc1, d1fnud1 complexed with cd |
PDB Entry: 1fnu (more details), 1.94 Å
SCOPe Domain Sequences for d1fnub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnub2 d.15.6.1 (B:408-521) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk
Timeline for d1fnub2: