Lineage for d6kack_ (6kac k:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026647Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 3026682Protein automated matches [339417] (5 species)
    not a true protein
  7. 3026683Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [378008] (1 PDB entry)
  8. 3026684Domain d6kack_: 6kac k: [378009]
    Other proteins in same PDB: d6kaca_, d6kacb_, d6kacc_, d6kacd_, d6kace_, d6kacf_, d6kacg_, d6kach_, d6kacj_, d6kacm_, d6kacn_, d6kaco_, d6kacp_, d6kacs_, d6kacy_, d6kacz_
    automated match to d5h2fk_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat

Details for d6kack_

PDB Entry: 6kac (more details), 2.7 Å

PDB Description: cryo-em structure of the c2s2-type psii-lhcii supercomplex from chlamydomonas reihardtii
PDB Compounds: (k:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d6kack_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kack_ f.23.36.1 (k:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
klpeayapfapivdvlpvipvffillafvwqaavsfr

SCOPe Domain Coordinates for d6kack_:

Click to download the PDB-style file with coordinates for d6kack_.
(The format of our PDB-style files is described here.)

Timeline for d6kack_: