![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) ![]() automatically mapped to Pfam PF02533 |
![]() | Family f.23.36.1: PsbK-like [161038] (2 proteins) Pfam PF02533 |
![]() | Protein automated matches [339417] (5 species) not a true protein |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [378008] (1 PDB entry) |
![]() | Domain d6kack_: 6kac k: [378009] Other proteins in same PDB: d6kaca_, d6kacb_, d6kacc_, d6kacd_, d6kace_, d6kacf_, d6kacg_, d6kach_, d6kacj_, d6kacm_, d6kacn_, d6kaco_, d6kacp_, d6kacs_, d6kacy_, d6kacz_ automated match to d5h2fk_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 6kac (more details), 2.7 Å
SCOPe Domain Sequences for d6kack_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kack_ f.23.36.1 (k:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} klpeayapfapivdvlpvipvffillafvwqaavsfr
Timeline for d6kack_: