| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
| Protein Streptococcal superantigen SSA [54354] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [54355] (1 PDB entry) |
| Domain d1bxtb2: 1bxt B:120-234 [37800] Other proteins in same PDB: d1bxta1, d1bxtb1 |
PDB Entry: 1bxt (more details), 1.85 Å
SCOPe Domain Sequences for d1bxtb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxtb2 d.15.6.1 (B:120-234) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
qiegkfpnitvkvyednenilsfdittnkkqvtvqeldcktrkilvsrknlyefnnspye
tgyikfiessgdsfwydmmpapgaifdqskylmlyndnktvsssaiaievhltkk
Timeline for d1bxtb2: