Lineage for d1et6a2 (1et6 A:100-209)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325849Protein Streptococcal superantigen Smez-2 [54352] (1 species)
  7. 325850Species Streptococcus pyogenes [TaxId:1314] [54353] (2 PDB entries)
  8. 325853Domain d1et6a2: 1et6 A:100-209 [37797]
    Other proteins in same PDB: d1et6a1, d1et6b1

Details for d1et6a2

PDB Entry: 1et6 (more details), 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes

SCOP Domain Sequences for d1et6a2:

Sequence, based on SEQRES records: (download)

>d1et6a2 d.15.6.1 (A:100-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
pknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrl
vfhtndnsdkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

Sequence, based on observed residues (ATOM records): (download)

>d1et6a2 d.15.6.1 (A:100-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
pknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyksgrl
vfhtkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

SCOP Domain Coordinates for d1et6a2:

Click to download the PDB-style file with coordinates for d1et6a2.
(The format of our PDB-style files is described here.)

Timeline for d1et6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1et6a1