Lineage for d1eu3b2 (1eu3 B:97-209)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018752Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1018753Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1018865Protein Streptococcal superantigen Smez-2 [54352] (1 species)
  7. 1018866Species Streptococcus pyogenes [TaxId:1314] [54353] (2 PDB entries)
  8. 1018868Domain d1eu3b2: 1eu3 B:97-209 [37796]
    Other proteins in same PDB: d1eu3a1, d1eu3b1
    complexed with k, po4, zn

Details for d1eu3b2

PDB Entry: 1eu3 (more details), 1.68 Å

PDB Description: crystal structure of the superantigen smez-2 (zinc bound) from streptococcus pyogenes
PDB Compounds: (B:) superantigen smez-2

SCOPe Domain Sequences for d1eu3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eu3b2 d.15.6.1 (B:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]}
tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks
grlvfhtndnsdkysfdlfyvgyrdkesifkvykdnksfnidkighldieids

SCOPe Domain Coordinates for d1eu3b2:

Click to download the PDB-style file with coordinates for d1eu3b2.
(The format of our PDB-style files is described here.)

Timeline for d1eu3b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eu3b1