| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) |
| Protein Streptococcal superantigen Smez-2 [54352] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [54353] (2 PDB entries) |
| Domain d1eu3b2: 1eu3 B:97-209 [37796] Other proteins in same PDB: d1eu3a1, d1eu3b1 |
PDB Entry: 1eu3 (more details), 1.68 Å
SCOP Domain Sequences for d1eu3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu3b2 d.15.6.1 (B:97-209) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
tsipknipvnlwingkqisvpyneistnkttvtaqeidlkvrkfliaqhqlyssgssyks
grlvfhtndnsdkysfdlfyvgyrdkesifkvykdnksfnidkighldieids
Timeline for d1eu3b2: