SCOPe 2.03: Domain d1eu4a2: 1eu4 A:96-204

Lineage for d1eu4a2 (1eu4 A:96-204)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Streptococcal superantigen Spe-H [54350] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54351] (2 PDB entries)

8. Domain d1eu4a2: 1eu4 A:96-204 [37794]
   Other proteins in same PDB: d1eu4a1
   complexed with zn

Details for d1eu4a2

PDB Entry: 1eu4, 2.5 Å

PDB Description: crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes

PDB Compounds: (A:) superantigen spe-h

SCOPe Domain Sequences for d1eu4a2:

Sequence; same for both SEQRES and ATOM records:

>d1eu4a2 d.15.6.1 (A:96-204) Streptococcal superantigen Spe-H {Streptococcus pyogenes [TaxId: 1314]}
ekkeikvpvnvwdkskqqppmfitvnkpkvtaqevdikvrkllikkydiynnreqkyskg
tvtldlnsgkdivfdlyyfgngdfnsmlkiysnneridstqfhvdvsis

Timeline for d1eu4a2:

• d1eu4a2 first appeared (with stable ids) in SCOP 1.55
  
• d1eu4a2 appears in SCOPe 2.02
  
• d1eu4a2 appears in SCOPe 2.04
  
• d1eu4a2 appears in the current release, SCOPe 2.08