Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
Protein Streptococcal superantigen Spe-H [54350] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [54351] (2 PDB entries) |
Domain d1et9a2: 1et9 A:96-204 [37793] Other proteins in same PDB: d1et9a1 |
PDB Entry: 1et9 (more details), 1.9 Å
SCOP Domain Sequences for d1et9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1et9a2 d.15.6.1 (A:96-204) Streptococcal superantigen Spe-H {Streptococcus pyogenes} ekkeikvpvnvwdkskqqppmfitvnkpkvtaqevdikvrkllikkydiynnreqkyskg tvtldlnsgkdivfdlyyfgngdfnsmlkiysnneridstqfhvdvsis
Timeline for d1et9a2: