SCOP 1.69: Domain d1hqrd2: 1hqr D:596-708

Lineage for d1hqrd2 (1hqr D:596-708)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Streptococcal superantigen Spe-C [54348] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)

8. Domain d1hqrd2: 1hqr D:596-708 [37792]
   Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrb2, d1hqrd1

Details for d1hqrd2

PDB Entry: 1hqr, 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqrd2:

Sequence; same for both SEQRES and ATOM records:

>d1hqrd2 d.15.6.1 (D:596-708) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

Timeline for d1hqrd2:

• d1hqrd2 first appeared (with stable ids) in SCOP 1.55
  
• d1hqrd2 appears in SCOP 1.67
  
• d1hqrd2 appears in SCOP 1.71
  
• d1hqrd2 appears in the current release, SCOPe 2.08