Lineage for d1hqrd2 (1hqr D:596-708)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131197Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 131198Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 131274Protein Streptococcal superantigen Spe-C [54348] (1 species)
  7. 131275Species Streptococcus pyogenes [TaxId:1314] [54349] (2 PDB entries)
  8. 131277Domain d1hqrd2: 1hqr D:596-708 [37792]
    Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrb2, d1hqrd1

Details for d1hqrd2

PDB Entry: 1hqr (more details), 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

SCOP Domain Sequences for d1hqrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hqrd2 d.15.6.1 (D:596-708) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

SCOP Domain Coordinates for d1hqrd2:

Click to download the PDB-style file with coordinates for d1hqrd2.
(The format of our PDB-style files is described here.)

Timeline for d1hqrd2: