Lineage for d1an8a2 (1an8 A:96-208)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403557Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1403702Protein Streptococcal superantigen Spe-C [54348] (1 species)
  7. 1403703Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)
  8. 1403704Domain d1an8a2: 1an8 A:96-208 [37791]
    Other proteins in same PDB: d1an8a1

Details for d1an8a2

PDB Entry: 1an8 (more details), 2.4 Å

PDB Description: crystal structure of the streptococcal superantigen spe-c
PDB Compounds: (A:) streptococcal pyrogenic exotoxin c

SCOPe Domain Sequences for d1an8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an8a2 d.15.6.1 (A:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

SCOPe Domain Coordinates for d1an8a2:

Click to download the PDB-style file with coordinates for d1an8a2.
(The format of our PDB-style files is described here.)

Timeline for d1an8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1an8a1