Lineage for d1an8_2 (1an8 96-208)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499977Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 499978Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 500092Protein Streptococcal superantigen Spe-C [54348] (1 species)
  7. 500093Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)
  8. 500094Domain d1an8_2: 1an8 96-208 [37791]
    Other proteins in same PDB: d1an8_1

Details for d1an8_2

PDB Entry: 1an8 (more details), 2.4 Å

PDB Description: crystal structure of the streptococcal superantigen spe-c

SCOP Domain Sequences for d1an8_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an8_2 d.15.6.1 (96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

SCOP Domain Coordinates for d1an8_2:

Click to download the PDB-style file with coordinates for d1an8_2.
(The format of our PDB-style files is described here.)

Timeline for d1an8_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1an8_1