SCOP 1.55: Domain d1an8_2: 1an8 96-208

Lineage for d1an8_2 (1an8 96-208)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Streptococcal superantigen Spe-C [54348] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54349] (2 PDB entries)

8. Domain d1an8_2: 1an8 96-208 [37791]
   Other proteins in same PDB: d1an8_1

Details for d1an8_2

PDB Entry: 1an8, 2.4 Å

PDB Description: crystal structure of the streptococcal superantigen spe-c

SCOP Domain Sequences for d1an8_2:

Sequence; same for both SEQRES and ATOM records:

>d1an8_2 d.15.6.1 (96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

Timeline for d1an8_2:

• d1an8_2 appears in SCOP 1.57
  
• d1an8_2 appears in the current release, SCOPe 2.08, called d1an8a2