Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
Protein Staphylococcal enterotoxin H, SEH [54346] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54347] (4 PDB entries) |
Domain d1f77b2: 1f77 B:102-213 [37790] Other proteins in same PDB: d1f77a1, d1f77b1 complexed with so4 |
PDB Entry: 1f77 (more details), 2.4 Å
SCOP Domain Sequences for d1f77b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f77b2 d.15.6.1 (B:102-213) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus} eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlyt
Timeline for d1f77b2: