SCOPe 2.06: Domain d1ewca2: 1ewc A:102-215

Lineage for d1ewca2 (1ewc A:102-215)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54347] (5 PDB entries)

8. Domain d1ewca2: 1ewc A:102-215 [37788]
   Other proteins in same PDB: d1ewca1
   complexed with zn

Details for d1ewca2

PDB Entry: 1ewc, 1.95 Å

PDB Description: crystal structure of zn2+ loaded staphylococcal enterotoxin h

PDB Compounds: (A:) enterotoxin h

SCOPe Domain Sequences for d1ewca2:

Sequence; same for both SEQRES and ATOM records:

>d1ewca2 d.15.6.1 (A:102-215) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlggendyeidkiyednktlksddishidvnlytkk

Timeline for d1ewca2:

• d1ewca2 first appeared (with stable ids) in SCOP 1.55
  
• d1ewca2 appears in SCOPe 2.05
  
• d1ewca2 appears in SCOPe 2.07
  
• d1ewca2 appears in the current release, SCOPe 2.08