Lineage for d1ewca2 (1ewc A:102-215)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499977Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 499978Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 500037Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)
  7. 500038Species Staphylococcus aureus [TaxId:1280] [54347] (4 PDB entries)
  8. 500040Domain d1ewca2: 1ewc A:102-215 [37788]
    Other proteins in same PDB: d1ewca1

Details for d1ewca2

PDB Entry: 1ewc (more details), 1.95 Å

PDB Description: crystal structure of zn2+ loaded staphylococcal enterotoxin h

SCOP Domain Sequences for d1ewca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewca2 d.15.6.1 (A:102-215) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlggendyeidkiyednktlksddishidvnlytkk

SCOP Domain Coordinates for d1ewca2:

Click to download the PDB-style file with coordinates for d1ewca2.
(The format of our PDB-style files is described here.)

Timeline for d1ewca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ewca1