Lineage for d6pzwg1 (6pzw G:3-95)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368997Domain d6pzwg1: 6pzw G:3-95 [377877]
    Other proteins in same PDB: d6pzwa_, d6pzwb_, d6pzwc_, d6pzwd_
    automated match to d4odhl1
    complexed with bma, man, nag

Details for d6pzwg1

PDB Entry: 6pzw (more details), 3 Å

PDB Description: cryoem derived model of na-22 fab in complex with n9 shanghai2
PDB Compounds: (G:) NA-22 fragment antigen binding light chain

SCOPe Domain Sequences for d6pzwg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pzwg1 b.1.1.0 (G:3-95) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqpasvsgspgqsitisctgtssdvggynyvswhqqhpgkapklmiydvsnrpsgvsn
rfsgsksgntasltisglqtedeadyycssytsst

SCOPe Domain Coordinates for d6pzwg1:

Click to download the PDB-style file with coordinates for d6pzwg1.
(The format of our PDB-style files is described here.)

Timeline for d6pzwg1: