![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
![]() | Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54345] (10 PDB entries) |
![]() | Domain d1jckd2: 1jck D:122-239 [37786] Other proteins in same PDB: d1jcka1, d1jcka2, d1jckb1, d1jckc1, d1jckc2, d1jckd1 mutant |
PDB Entry: 1jck (more details), 3.5 Å
SCOP Domain Sequences for d1jckd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jckd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus} hfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy etgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng
Timeline for d1jckd2: