Lineage for d1jckd2 (1jck D:122-239)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78065Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 78066Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 78101Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 78102Species Staphylococcus aureus [TaxId:1280] [54345] (1 PDB entry)
  8. 78104Domain d1jckd2: 1jck D:122-239 [37786]
    Other proteins in same PDB: d1jcka1, d1jcka2, d1jckb1, d1jckc1, d1jckc2, d1jckd1

Details for d1jckd2

PDB Entry: 1jck (more details), 3.5 Å

PDB Description: t-cell receptor beta chain complexed with sec3 superantigen

SCOP Domain Sequences for d1jckd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jckd2 d.15.6.1 (D:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
hfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng

SCOP Domain Coordinates for d1jckd2:

Click to download the PDB-style file with coordinates for d1jckd2.
(The format of our PDB-style files is described here.)

Timeline for d1jckd2: