Lineage for d1jckb2 (1jck B:122-239)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403556Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1403557Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1403616Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)
  7. 1403617Species Staphylococcus aureus [TaxId:1280] [54345] (18 PDB entries)
    Uniprot P23313
  8. 1403644Domain d1jckb2: 1jck B:122-239 [37785]
    Other proteins in same PDB: d1jcka1, d1jcka2, d1jckb1, d1jckc1, d1jckc2, d1jckd1

Details for d1jckb2

PDB Entry: 1jck (more details), 3.5 Å

PDB Description: t-cell receptor beta chain complexed with sec3 superantigen
PDB Compounds: (B:) staphylococcal enterotoxin c3

SCOPe Domain Sequences for d1jckb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jckb2 d.15.6.1 (B:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng

SCOPe Domain Coordinates for d1jckb2:

Click to download the PDB-style file with coordinates for d1jckb2.
(The format of our PDB-style files is described here.)

Timeline for d1jckb2: